Recombinant Human TXNL4B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TXNL4B-4893H
Product Overview : TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : TXNL4B (Thioredoxin Like 4B) is a Protein Coding gene. Diseases associated with TXNL4B include Anhaptoglobinemia and Epithelial-Stromal Tgfbi Dystrophy. An important paralog of this gene is TXNL4A.
Molecular Mass : 17 kDa
AA Sequence : MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TXNL4B thioredoxin-like 4B [ Homo sapiens (human) ]
Official Symbol TXNL4B
Synonyms TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511; Dim1-like protein;
Gene ID 54957
mRNA Refseq NM_001142318
Protein Refseq NP_001135790
MIM 617722
UniProt ID Q9NX01

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TXNL4B Products

Required fields are marked with *

My Review for All TXNL4B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon