Description :	Thioredoxin-like 4B is a protein that is encoded by the TXNL4B gene.
Protein length :	149 amino acids
Conjugation :	HIS
Molecular Weight :	21.100kDa inclusive of tags
Source :	E. coli
Form :	Liquid
Purity :	>90% by SDS-PAGE
Storage buffer :	Preservative: NoneConstituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
Storage :	Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids :	MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
Sequence Similarities :	Belongs to the DIM1 family.

Gene Name	TXNL4B thioredoxin-like 4B [ Homo sapiens ]
Official Symbol	TXNL4B
Synonyms	TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511;
Gene ID	54957
mRNA Refseq	NM_017853
Protein Refseq	NP_060323
Uniprot ID	Q9NX01
Chromosome Location	16q22.2