Recombinant Human TXNL4B, His-tagged

• Cat.No.: TXNL4B-31638TH
• Product Overview: Recombinant full length Human TXNL4B with an N terminal His tag; 185 amino acids with tag, MWt 21.1 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 149 amino acids
• Description: Thioredoxin-like 4B is a protein that is encoded by the TXNL4B gene.
• Conjugation: HIS
• Molecular Weight: 21.100kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI
• Sequence Similarities: Belongs to the DIM1 family.

Gene Information

• Gene Name: TXNL4B thioredoxin-like 4B [ Homo sapiens ]
• Official Symbol: TXNL4B
• Synonyms: TXNL4B; thioredoxin-like 4B; thioredoxin-like protein 4B; Dim2; DLP; FLJ20511
• Gene ID: 54957
• mRNA Refseq: NM_017853
• Protein Refseq: NP_060323
• Uniprot ID: Q9NX01
• Chromosome Location: 16q22.2