Recombinant Human TXNDC17 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TXNDC17-4645H
• Product Overview: TXNDC17 MS Standard C13 and N15-labeled recombinant protein (NP_116120) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TXNDC17 (Thioredoxin Domain Containing 17) is a Protein Coding gene. Diseases associated with TXNDC17 include Parametritis and Eiken Syndrome. Gene Ontology (GO) annotations related to this gene include electron transfer activity and protein-disulfide reductase activity.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.9 kDa
• AA Sequence: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSEDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TXNDC17 thioredoxin domain containing 17 [ Homo sapiens (human) ]
• Official Symbol: TXNDC17
• Synonyms: TXNDC17; thioredoxin domain containing 17; TRP14; TXNL5; thioredoxin domain-containing protein 17; 14 kDa thioredoxin-related protein; protein 42-9-9; testicular tissue protein Li 214; thioredoxin (Trx)-related protein, 14 kDa; thioredoxin-like 5; thioredoxin-like protein 5
• Gene ID: 84817
• mRNA Refseq: NM_032731
• Protein Refseq: NP_116120
• MIM: 616967
• UniProt ID: Q9BRA2