Recombinant Human TXLNA protein, His-tagged
Cat.No. : | TXLNA-2892H |
Product Overview : | Recombinant Human TXLNA protein(1-69 aa), fused to His tag, was expressed in E. coli. |
Availability | April 17, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-69 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | TXLNA taxilin alpha [ Homo sapiens ] |
Official Symbol | TXLNA |
Synonyms | TXLNA; taxilin alpha; alpha-taxilin; DKFZp451J0118; interleukin 14; IL14; TXLN; RP4-622L5.4; MGC118870; MGC118871; |
Gene ID | 200081 |
mRNA Refseq | NM_175852 |
Protein Refseq | NP_787048 |
MIM | 608676 |
UniProt ID | P40222 |
◆ Recombinant Proteins | ||
TXLNA-4537H | Recombinant Human TXLNA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
TXLNA-303HFL | Recombinant Full Length Human TXLNA Protein, C-Flag-tagged | +Inquiry |
TXLNA-2281H | Recombinant Human TXLNA Protein, His (Fc)-Avi-tagged | +Inquiry |
Txlna-425M | Recombinant Mouse Txlna Protein, MYC/DDK-tagged | +Inquiry |
TXLNA-3396H | Recombinant Human TXLNA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TXLNA-629HCL | Recombinant Human TXLNA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TXLNA Products
Required fields are marked with *
My Review for All TXLNA Products
Required fields are marked with *
0
Inquiry Basket