Recombinant Human TSACC Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TSACC-1134H
• Product Overview: C1orf182 MS Standard C13 and N15-labeled recombinant protein (NP_653228) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TSACC (TSSK6 Activating Cochaperone) is a Protein Coding gene. Diseases associated with TSACC include Adrenal Insufficiency, Congenital, With 46,Xy Sex Reversal, Partial Or Complete. Gene Ontology (GO) annotations related to this gene include chaperone binding.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 13.7 kDa
• AA Sequence: MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLGLLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TSACC TSSK6 activating cochaperone [ Homo sapiens (human) ]
• Official Symbol: TSACC
• Synonyms: TSACC; TSSK6 activating cochaperone; SIP; SSTK-IP; C1orf182; TSSK6-activating co-chaperone protein; SSTK-interacting protein (SSTK-IP); TSSK6 activating co-chaperone
• Gene ID: 128229
• mRNA Refseq: NM_144627
• Protein Refseq: NP_653228
• UniProt ID: Q96A04