Recombinant Human TSACC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TSACC-1134H
Product Overview : C1orf182 MS Standard C13 and N15-labeled recombinant protein (NP_653228) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : TSACC (TSSK6 Activating Cochaperone) is a Protein Coding gene. Diseases associated with TSACC include Adrenal Insufficiency, Congenital, With 46,Xy Sex Reversal, Partial Or Complete. Gene Ontology (GO) annotations related to this gene include chaperone binding.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 13.7 kDa
AA Sequence : MERHTSHPNRKVPAKEEANAVPLCRAKPSPSYINLQASSPPATFLNIQTTKLPSVDHKPKECLGLLECMYANLQLQTQLAQQQMAVLEHLQASVTQLAPGRGSNNSSLPALSPNPLLNHLPQFSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TSACC TSSK6 activating cochaperone [ Homo sapiens (human) ]
Official Symbol TSACC
Synonyms TSACC; TSSK6 activating cochaperone; SIP; SSTK-IP; C1orf182; TSSK6-activating co-chaperone protein; SSTK-interacting protein (SSTK-IP); TSSK6 activating co-chaperone
Gene ID 128229
mRNA Refseq NM_144627
Protein Refseq NP_653228
UniProt ID Q96A04

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TSACC Products

Required fields are marked with *

My Review for All TSACC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon