Recombinant Human TRMT44 Protein, GST-tagged

• Cat.No.: TRMT44-5228H
• Product Overview: Human C4orf23 full-length ORF ( NP_689757.1, 1 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a putative tRNA methyltransferase found in the cytoplasm. Defects in this gene may be a cause of partial epilepsy with pericentral spikes (PEPS), but that has not been proven definitively. [provided by RefSeq, May 2012]
• Molecular Mass: 67.7 kDa
• AA Sequence: MYGPQTQLEEDAITPNDKTLFPDVDWLIGNHSDELTPWIPVIAARSSYNCRFFVLPCCFFDFIGRYSRRQSKKTQYREYLDFIKEVGFTCGFHVDEDCLRIPSTKRVCLVGKSRTYPSSREASVDEKRTQYIKSRRGCPVSPPGWELSPSPRWVAAGSAGHCDGQQALDARVGCVTRAWAAEHGAGPQAEGPWLPGFHPREKAERVRNCAALPRDFIDQVVLQVANLLLGGKQLNTRSSRNGSLKTWNGGESLSLAEVANELDTETLRRLKRECGGLQTLLRNSHQVFQVVNGRVHIRDWREETLWKTKQPEAKQRLLSEACKTRLCWFFMHHPDGCALSTDCCPFAHGPAELRPPRTTPRKKIS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRMT44 tRNA methyltransferase 44 homolog [ Homo sapiens (human) ]
• Official Symbol: TRMT44
• Synonyms: TRNA Methyltransferase 44 Homolog (S. Cerevisiae); Methyltransferase-Like Protein 19; Methyltransferase Like 19; C4orf23; METTL19; Probable TRNA (Uracil-O(2)-)-Methyltransferase; Chromosome 4 Open Reading Frame 23; EC 2.1.1.211; EC 2.1.1; TRM44; TRMT44; tRNA methyltransferase 44 homolog; probable tRNA (uracil-O(2)-)-methyltransferase; methyltransferase like 19; methyltransferase-like protein 19
• Gene ID: 152992
• mRNA Refseq: NM_001350233
• Protein Refseq: NP_001337162
• MIM: 614309
• UniProt ID: Q8IYL2