Recombinant Human TRMO Protein, GST-Tagged
Cat.No. : | TRMO-0189H |
Product Overview : | Human C9orf156 full-length ORF (AAH02863.1, 1 a.a. - 441 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Description : | TRMO (TRNA Methyltransferase O) is a Protein Coding gene. Diseases associated with TRMO include Isolated Cleft Lip. |
Source : | Wheat Germ |
Species : | Human |
Tag : | GST |
Molecular Mass : | 75 kDa |
AA Sequence : | MRGLEEPGPRPTATPCGCVKPALETGNLLTEPVGYLESCFSAKNGTPRQPSICSYSRACLRIRKRIFNNPEHSLMGLEQFSHVWILFVFHKNGHLSCKAKVQPPRLNGAKTGVFSTRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPEDRTSEENYLTHSDTARIQQAFPMHREIAVDFGLESRRDQSSSVAEEQIGPYCPEKSFSEKGTDKKLERVEGAAVLQGSRAETQPMAPHCPAGRADGAPRSVVPAWVTEAPVATLEVRFTPHAEMDLGQLSSQDVGQASFKYFQSAEEAKRAIEAVLSADPRSVYRRKLCQDRLFYFTVDIAHVTCWFGDGFAEVLRIKPASEPVHMTGPVGSLVSLGS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | TRMO tRNA methyltransferase O [ Homo sapiens (human) ] |
Official Symbol | TRMO |
Synonyms | TRMO; tRNA methyltransferase O; C9ORF156; chromosome 9 open reading frame 156; nef-associated protein 1; HSPC219; NAP1; Nef (lentivirus myristoylated factor) associated protein 1; thioesterase NAP1; Nef associated protein 1; RP11-23B15.3; |
Gene ID | 51531 |
mRNA Refseq | NM_016481 |
Protein Refseq | NP_057565 |
UniProt ID | Q9BU70 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRMO Products
Required fields are marked with *
My Review for All TRMO Products
Required fields are marked with *
0
Inquiry Basket