Recombinant Human TRBC2 protein, His&Myc-tagged
Cat.No. : | TRBC2-3620H |
Product Overview : | Recombinant Human TRBC2 protein(A0A5B9)(1-129aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
ProteinLength : | 1-129aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 19.7 kDa |
AA Sequence : | DLKNVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
◆ Recombinant Proteins | ||
SGR-RS19910-823S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS19910 protein, His-tagged | +Inquiry |
CDC20-0910H | Recombinant Human CDC20 Protein, GST-Tagged | +Inquiry |
TBXA2R-16536M | Recombinant Mouse TBXA2R Protein | +Inquiry |
IFT27-8051M | Recombinant Mouse IFT27 Protein | +Inquiry |
ZNF596-357H | Recombinant Human ZNF596 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PGI-31 | Active Native Phosphoglucose isomerase | +Inquiry |
HB-45R | Native Simian Hemoglobin (HB) Protein | +Inquiry |
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
DI-24 | Active Native Diaphorase (NADH) | +Inquiry |
BOD-38 | Active Native Bilirubin oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
TOMM34-870HCL | Recombinant Human TOMM34 293 Cell Lysate | +Inquiry |
MBNL3-1067HCL | Recombinant Human MBNL3 cell lysate | +Inquiry |
NR6A1-3704HCL | Recombinant Human NR6A1 293 Cell Lysate | +Inquiry |
PROC-747MCL | Recombinant Mouse PROC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRBC2 Products
Required fields are marked with *
My Review for All TRBC2 Products
Required fields are marked with *
0
Inquiry Basket