Recombinant Human TRAPPC2L Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TRAPPC2L-3151H
• Product Overview: TRAPPC2L MS Standard C13 and N15-labeled recombinant protein (NP_057293) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a protein that interacts with the tethering factor trafficking protein particle (TRAPP complex). TRAPP complexes mediate the contact between vescicles and target membranes, and thus, are involved in vescicle-mediated transport of proteins and lipids. The encoded protein is related to the X-linked trafficking protein particle complex 2. A related pseudogene is located on the X chromosome. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.1 kDa
• AA Sequence: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TRAPPC2L trafficking protein particle complex 2-like [ Homo sapiens (human) ]
• Official Symbol: TRAPPC2L
• Synonyms: TRAPPC2L; trafficking protein particle complex 2-like; PERRB; HSPC176; trafficking protein particle complex subunit 2-like protein; hematopoietic stem/progenitor cells 176
• Gene ID: 51693
• mRNA Refseq: NM_016209
• Protein Refseq: NP_057293
• MIM: 610970
• UniProt ID: Q9UL33