Recombinant Human TRAPPC13 Protein, GST-Tagged

• Cat.No.: TRAPPC13-0094H
• Product Overview: Human TRAPPC13 full-length ORF (BAB14633.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: TRAPPC13 (Trafficking Protein Particle Complex 13) is a Protein Coding gene. Among its related pathways are Vesicle-mediated transport and RAB GEFs exchange GTP for GDP on RABs.
• Molecular Mass: 65.9 kDa
• AA Sequence: MLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKADLQTSSQRLNLSASNAAVAELKPDCCIDDVIHHEVKEIGTHILVCAVSYTTQAGEKMYFRKFFKFQVLKPLDVKTKFYNAESDLSSVTDEVFLEAQIQNMTTSPMFMEKVSLEPSIMYNVTELNSVSQAGECVSTFGSRAYLQPMDTRQYLYCLKPKNEFAEKAGIIKGVTVIGKLDIVWKTNLGERGRLQTSQLQRMAPGYGDVRLSLEAIPDTVNLEEPFHITCKITNCSERTMDLVLEMCNTNSIHWCGISGRQLGKLHPSSSLCLALTLLSSVQGLQSISGLRLTDTFLKRTYEYDDIAQVCVVSSAIKVER
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: TRAPPC13 trafficking protein particle complex 13 [ Homo sapiens (human) ]
• Official Symbol: TRAPPC13
• Synonyms: TRAPPC13; trafficking protein particle complex 13; C5orf44; Trafficking Protein Particle Complex 13; Trs65-Related; Trafficking Protein Particle Complex Subunit 13; Chromosome 5 Open Reading Frame 44; UPF0533 Protein C5orf44; trafficking protein particle complex subunit 13; Trs65-related; UPF0533 protein C5orf44
• Gene ID: 80006
• mRNA Refseq: NM_024941
• Protein Refseq: NP_079217
• UniProt ID: A5PLN9