Description :	TPRA1 (Transmembrane Protein Adipocyte Associated 1) is a Protein Coding gene. GO annotations related to this gene include G-protein coupled receptor activity.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	35.75 kDa
AA Sequence :	RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	TPRA1 transmembrane protein adipocyte associated 1 [ Homo sapiens (human) ]
Official Symbol	TPRA1
Synonyms	TPRA1; transmembrane protein adipocyte associated 1; GPR175; TPRA40; TMEM227; transmembrane protein adipocyte-associated 1; G protein-coupled receptor 175; integral membrane protein GPR175; seven transmembrane domain orphan receptor; transmembrane domain protein regulated in adipocytes 40 kDa; transmembrane protein 227; transmembrane protein, adipocyte asscociated 1
Gene ID	131601
mRNA Refseq	NM_001136053
Protein Refseq	NP_001129525
MIM	608336
UniProt ID	Q86W33