Recombinant Human TPPP protein, GST-tagged

• Cat.No.: TPPP-3613H
• Product Overview: Recombinant Human TPPP protein(O94811)(1-219aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-219aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 50.7 kDa
• AA Sequence: MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSALEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVFSKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPIISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESGYVSGYKHAGTYDQKVQGGK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TPPP tubulin polymerization promoting protein [ Homo sapiens ]
• Official Symbol: TPPP
• Synonyms: TPPP; tubulin polymerization promoting protein; tubulin polymerization-promoting protein; brain specific protein p25 alpha; p25; p25alpha; TPPP/p25; TPPP1; p25-alpha; 25 kDa brain-specific protein; glycogen synthase kinase 3 (GSK3) inhibitor p24; p24
• Gene ID: 11076
• mRNA Refseq: NM_007030
• Protein Refseq: NP_008961
• MIM: 608773
• UniProt ID: O94811