Recombinant Human TOMM6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TOMM6-4737H
• Product Overview: TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TOMM6 (Translocase Of Outer Mitochondrial Membrane 6) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitophagy.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.8 kDa
• AA Sequence: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQPGVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TOMM6 translocase of outer mitochondrial membrane 6 [ Homo sapiens (human) ]
• Official Symbol: TOMM6
• Synonyms: TOMM6; translocase of outer mitochondrial membrane 6; OBTP; TOM6; mitochondrial import receptor subunit TOM6 homolog; over-expressed breast tumor protein; overexpressed breast tumor protein; translocase of outer membrane 6 kDa subunit homolog; translocase of outer mitochondrial membrane 6 homolog
• Gene ID: 100188893
• mRNA Refseq: NM_001134493
• Protein Refseq: NP_001127965
• MIM: 616168
• UniProt ID: Q96B49