Recombinant Human TNFSF9 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TNFSF9-5902H
• Product Overview: TNFSF9 MS Standard C13 and N15-labeled recombinant protein (NP_003802) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.
• Molecular Mass: 26.6 kDa
• AA Sequence: MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TNFSF9 TNF superfamily member 9 [ Homo sapiens (human) ]
• Official Symbol: TNFSF9
• Synonyms: TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L
• Gene ID: 8744
• mRNA Refseq: NM_003811
• Protein Refseq: NP_003802
• MIM: 606182
• UniProt ID: P41273