Recombinant Human TNFSF9 protein

• Cat.No.: TNFSF9-924H
• Product Overview: Recombinant Human TNFSF9 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 184
• Description: 4-1BBL is a member of the tumor necrosis factor (TNF) receptor family. This receptor contributes to the clonal expansion, survival, and development of T cells. In addition, 4-1BBL expression is found on dendritic cells, follicular dendritic cells, natural killer cells, granulocytes and cells of blood vessel walls at sites of inflammation. CD137 has been shown to interact with TRAF2. The human 4-1BBL gene codes for a 254 amino acid type II transmembrane containing a 28 amino acid cytoplasmic domain, a 21 amino acid transmembrane domain, and a 205 amino acid extracellular domain (ECD). The human 4­1BBL ECD shares 32 % and 35 % a.a. identity with murine and rat ECD.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by stimulation of IL-8 production using human PBMC is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
• Molecular Mass: Approximately 19.4 kDa, a single non-glycosylated polypeptide chain containing 184 amino acids.
• AA Sequence: REGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
• Endotoxin: Less than 1 EU/µg of rHu4-1BBL as determined by LAL method.
• Purity: >95% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFSF9
• Official Symbol: TNFSF9
• Synonyms: TNFSF9; tumor necrosis factor (ligand) superfamily, member 9; tumor necrosis factor ligand superfamily member 9; 4 1BB L; homolog of mouse 4 1BB L; receptor 4 1BB ligand; 4-1BBL; 4-1BB ligand; receptor 4-1BB ligand; homolog of mouse 4-1BB-L; CD137L; 4-1BB-L
• Gene ID: 8744
• mRNA Refseq: NM_003811
• Protein Refseq: NP_003802
• MIM: 606182
• UniProt ID: P41273