Recombinant Human TNFSF4 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: TNFSF4-086H
• Product Overview: TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 20.9 kDa
• AA Sequence: MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TNFSF4 TNF superfamily member 4 [ Homo sapiens (human) ]
• Official Symbol: TNFSF4
• Synonyms: TNFSF4; TNF superfamily member 4; CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1; tumor necrosis factor ligand superfamily member 4; CD134 ligand; OX40 antigen ligand; glycoprotein Gp34; tax-transcriptionally activated glycoprotein 1 (34kD); tumor necrosis factor (ligand) superfamily member 4; tumor necrosis factor ligand 2B; tumor necrosis factor superfamily member 4
• Gene ID: 7292
• mRNA Refseq: NM_003326
• Protein Refseq: NP_003317
• MIM: 603594
• UniProt ID: P23510