Active Recombinant Human TNFRSF9 Protein

• Cat.No.: TNFRSF9-517H
• Product Overview: Recombinant Human TNFRSF9 protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 166
• Description: 4-1BB receptor, also named TNFRSF9 is a member of the TNF superfamily of receptors. It is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB receptor binds to 4-1BBL, and they co-stimulate activity for activated T cells. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. Crosslinking of 4-1BB Receptor enhances T cell proliferation, IL-2 secretion survival and cytolytic activity. Further, it can enhance immune activity to eliminate tumors in mice.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 10 mM PB, pH 8.0, 150 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity is determined by its inhibitory effect of IL-8 production using human peripheral blood mononuclear cells. About 90 % of inibition was seen using a concentration of 1 µg for both 4-1BB Ligand and 4-1BB Receptor.
• Molecular Mass: Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 166 amino acids.
• AA Sequence: ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS
• Endotoxin: Less than 1 EU/μg of rHu4-1BB Receptor as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFRSF9
• Official Symbol: TNFRSF9
• Synonyms: TNFRSF9; tumor necrosis factor receptor superfamily, member 9; ILA; tumor necrosis factor receptor superfamily member 9; 4 1BB; CD137; CD137 antigen; T cell antigen ILA; T-cell antigen ILA; 4-1BB ligand receptor; homolog of mouse 4-1BB; receptor protein 4-1BB; T-cell antigen 4-1BB homolog; induced by lymphocyte activation (ILA); interleukin-activated receptor, homolog of mouse Ly63; 4-1BB; CDw137; MGC2172; FLJ43501
• Gene ID: 3604
• mRNA Refseq: NM_001561
• Protein Refseq: NP_001552
• MIM: 602250
• UniProt ID: Q07011