Recombinant Human TNFRSF4 protein(141-210 aa), C-His-tagged
Cat.No. : | TNFRSF4-2764H |
Product Overview : | Recombinant Human TNFRSF4 protein(P43489)(141-210 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 141-210 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP |
Gene Name | TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ] |
Official Symbol | TNFRSF4 |
Synonyms | TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor; |
Gene ID | 7293 |
mRNA Refseq | NM_003327 |
Protein Refseq | NP_003318 |
MIM | 600315 |
UniProt ID | P43489 |
◆ Recombinant Proteins | ||
Tnfrsf4-547MAF647 | Recombinant Mouse Tnfrsf4 Protein, Alexa Fluor 647 conjugated | +Inquiry |
TNFRSF4-549RAF555 | Recombinant Monkey TNFRSF4 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
TNFRSF4-1566R | Recombinant Rhesus Monkey TNFRSF4 Protein, hIgG4-tagged | +Inquiry |
TNFRSF4-682M | Recombinant Mouse TNFRSF4 Protein | +Inquiry |
Tnfrsf4-7075M | Recombinant Mouse Tnfrsf4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF4-2422HCL | Recombinant Human TNFRSF4 cell lysate | +Inquiry |
TNFRSF4-1762MCL | Recombinant Mouse TNFRSF4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF4 Products
Required fields are marked with *
My Review for All TNFRSF4 Products
Required fields are marked with *
0
Inquiry Basket