Recombinant Human TNFRSF4 protein(141-210 aa), C-His-tagged

• Cat.No.: TNFRSF4-2764H
• Product Overview: Recombinant Human TNFRSF4 protein(P43489)(141-210 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 141-210 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: CKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVP

Gene Information

• Gene Name: TNFRSF4 tumor necrosis factor receptor superfamily, member 4 [ Homo sapiens ]
• Official Symbol: TNFRSF4
• Synonyms: TNFRSF4; tumor necrosis factor receptor superfamily, member 4; TXGP1L; tumor necrosis factor receptor superfamily member 4; ACT35; CD134; OX40; OX40 antigen; ACT35 antigen; ATC35 antigen; CD134 antigen; OX40 homologue; OX40L receptor; OX40 cell surface antigen; lymphoid activation antigene ACT35; TAX transcriptionally-activated glycoprotein 1 receptor; tax-transcriptionally activated glycoprotein 1 receptor
• Gene ID: 7293
• mRNA Refseq: NM_003327
• Protein Refseq: NP_003318
• MIM: 600315
• UniProt ID: P43489