Recombinant Human TNFRSF25 Protein (25-199 aa), His-tagged

• Cat.No.: TNFRSF25-2154H
• Product Overview: Recombinant Human TNFRSF25 Protein (25-199 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 25-199 aa
• Description: Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 22.9 kDa
• AA Sequence: QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: TNFRSF25 tumor necrosis factor receptor superfamily, member 25 [ Homo sapiens ]
• Official Symbol: TNFRSF25
• Synonyms: TNFRSF25; APO 3; DDR3; DR3; LARD; TR3; TRAMP; WSL 1; WSL LR; protein WSL-1; APO-3; WSL-1; WSL-LR; TNFRSF12
• Gene ID: 8718
• mRNA Refseq: NM_001039664
• Protein Refseq: NP_001034753
• MIM: 603366
• UniProt ID: Q93038