Recombinant Human TNFRSF1B protein, GST-tagged

• Cat.No.: TNFRSF1B-3600H
• Product Overview: Recombinant Human TNFRSF1B protein(P20333)(27-203aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 27-203aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 46.3 kDa
• AA Sequence: VAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTST
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TNFRSF1B tumor necrosis factor receptor superfamily, member 1B [ Homo sapiens ]
• Official Symbol: TNFRSF1B
• Synonyms: TNFRSF1B; tumor necrosis factor receptor superfamily, member 1B; TNFR2; tumor necrosis factor receptor superfamily member 1B; CD120b; p75; TNF R II; TNF R75; TNFBR; TNFR80; TNF-R2; TNF-RII; p75 TNF receptor; p80 TNF-alpha receptor; soluble TNFR1B variant 1; tumor necrosis factor receptor 2; tumor necrosis factor beta receptor; tumor necrosis factor receptor type II; tumor necrosis factor binding protein 2; TBPII; TNFR1B; TNF-R75; p75TNFR; TNF-R-II
• Gene ID: 7133
• mRNA Refseq: NM_001066
• Protein Refseq: NP_001057
• MIM: 191191
• UniProt ID: P20333