Recombinant Human TNFRSF1A protein

• Cat.No.: TNFRSF1A-248H
• Product Overview: Recombinant Human TNFRSF1A protein was expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 190
• Description: This gene encodes a member of the TNF receptor superfamily of proteins. The encoded receptor is found in membrane-bound and soluble forms that interact with membrane-bound and soluble forms, respectively, of its ligand, tumor necrosis factor alpha. Binding of membrane-bound tumor necrosis factor alpha to the membrane-bound receptor induces receptor trimerization and activation, which plays a role in cell survival, apoptosis, and inflammation. Proteolytic processing of the encoded receptor results in release of the soluble form of the receptor, which can interact with free tumor necrosis factor alpha to inhibit inflammation. Mutations in this gene underlie tumor necrosis factor receptor-associated periodic syndrome (TRAPS), characterized by fever, abdominal pain and other features. Mutations in this gene may also be associated with multiple sclerosis in human patients.
• Form: Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit the TNF-alpha mediated cytotoxicity in the L-929 cells is less than 0.05 μg/ml, corresponding to a specific activity of > 2 × 104IU/mg in the presence of 0.25 ng/mL of rHuTNF-alpha.
• Molecular Mass: Approximately 21.2 kDa, a single non-glycosylated polypeptide chain containing 190 amino acids.
• AA Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
• Endotoxin: Less than 0.1 EU/µg of rHusTNF RI/TNFRSF1A as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFRSF1A
• Official Symbol: TNFRSF1A
• Synonyms: TNFRSF1A; tumor necrosis factor receptor superfamily, member 1A; TNFR1; tumor necrosis factor receptor superfamily member 1A; CD120a; TNF R; TNF R I; TNF R55; TNFAR; TNFR60; TNF-R1; TNF-RI; TNFR-I; tumor necrosis factor-alpha receptor; tumor necrosis factor receptor type 1; tumor necrosis factor binding protein 1; tumor necrosis factor receptor 1A isoform beta; FPF; p55; p60; TBP1; TNF-R; p55-R; TNFR55; TNF-R-I; TNF-R55; MGC19588
• Gene ID: 7132
• mRNA Refseq: NM_001065
• Protein Refseq: NP_001056
• MIM: 191190
• UniProt ID: P19438