Recombinant Human TNFRSF17 Protein (50 aa)

• Cat.No.: TNFRSF17-136T
• Product Overview: Recombinant Human TNFRSF17 Protein without tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 50
• Description: BCMA, a member of the TNF receptor superfamily, binds to BAFF and APRIL. BCMA is expressed on mature B-cells and other B-cell lines and plays an important role in B cell development, function and regulation. BCMA also has the capability to activate NF-kappaB and JNK. The human BCMA gene codes for a 184 amino acid type I transmembrane protein, which contains a 54 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 107 amino acid extracellular domain.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: Data Not Available.
• Molecular Mass: Approximately 5.3 KDa, a single non-glycosylated polypeptide chain containing 50 amino acids.
• AA Sequence: AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
• Endotoxin: Less than 1 EU/mg of rHuIL-1α as determined by LAL method.
• Purity: >98% by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
• Storage Buffer: Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: TNFRSF17 tumor necrosis factor receptor superfamily, member 17 [ Homo sapiens ]
• Official Symbol: TNFRSF17
• Synonyms: TNFRSF17; tumor necrosis factor receptor superfamily, member 17; BCMA; tumor necrosis factor receptor superfamily member 17; BCM; CD269; B-cell maturation factor; B cell maturation antigen; B-cell maturation protein
• Gene ID: 608
• mRNA Refseq: NM_001192
• Protein Refseq: NP_001183
• MIM: 109545
• UniProt ID: Q02223