Recombinant Human TNFRSF17 Protein (50 aa)
Cat.No. : | TNFRSF17-136T |
Product Overview : | Recombinant Human TNFRSF17 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 50 |
Description : | BCMA, a member of the TNF receptor superfamily, binds to BAFF and APRIL. BCMA is expressed on mature B-cells and other B-cell lines and plays an important role in B cell development, function and regulation. BCMA also has the capability to activate NF-kappaB and JNK. The human BCMA gene codes for a 184 amino acid type I transmembrane protein, which contains a 54 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 107 amino acid extracellular domain. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Data Not Available. |
Molecular Mass : | Approximately 5.3 KDa, a single non-glycosylated polypeptide chain containing 50 amino acids. |
AA Sequence : | AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA |
Endotoxin : | Less than 1 EU/mg of rHuIL-1α as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2μm filtered concentrated solution in 30% acetonitrile, 0.1% TFA. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | TNFRSF17 tumor necrosis factor receptor superfamily, member 17 [ Homo sapiens ] |
Official Symbol | TNFRSF17 |
Synonyms | TNFRSF17; tumor necrosis factor receptor superfamily, member 17; BCMA; tumor necrosis factor receptor superfamily member 17; BCM; CD269; B-cell maturation factor; B cell maturation antigen; B-cell maturation protein; |
Gene ID | 608 |
mRNA Refseq | NM_001192 |
Protein Refseq | NP_001183 |
MIM | 109545 |
UniProt ID | Q02223 |
◆ Recombinant Proteins | ||
TNFRSF17-2921R | Active Recombinant Rat TNFRSF17 protein, His-tagged | +Inquiry |
TNFRSF17-324M | Active Recombinant Mouse TNFRSF17 protein, His-tagged | +Inquiry |
TNFRSF17-239H | Active Recombinant Human TNFRSF17 Protein, Fc-tagged, FITC-Labeled | +Inquiry |
TNFRSF17-26737TH | Recombinant Human TNFRSF17 protein | +Inquiry |
TNFRSF17-237HP | Recombinant Human TNFRSF17 protein, Fc-tagged, R-PE labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFRSF17-1253CCL | Recombinant Cynomolgus TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2593MCL | Recombinant Mouse TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-1489RCL | Recombinant Rat TNFRSF17 cell lysate | +Inquiry |
TNFRSF17-2489HCL | Recombinant Human TNFRSF17 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNFRSF17 Products
Required fields are marked with *
My Review for All TNFRSF17 Products
Required fields are marked with *
0
Inquiry Basket