Recombinant Human TNFRSF14 Protein, Strep-tagged

• Cat.No.: TNFRSF14-671H
• Product Overview: Recombinant human TNFRSF14 protein with Strep tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Strep
• ProteinLength: 283
• Description: This gene encodes a member of the TNF (tumor necrosis factor) receptor superfamily. The encoded protein functions in signal transduction pathways that activate inflammatory and inhibitory T-cell immune response. It binds herpes simplex virus (HSV) viral envelope glycoprotein D (gD), mediating its entry into cells. Alternative splicing results in multiple transcript variants.
• Form: Lyophilized
• Molecular Mass: 20.4 kDa
• AA Sequence: MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVSVQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: TNFRSF14 tumor necrosis factor receptor superfamily, member 14 [ Homo sapiens (human) ]
• Official Symbol: TNFRSF14
• Synonyms: TNFRSF14; tumor necrosis factor receptor superfamily, member 14; tumor necrosis factor receptor superfamily, member 14 (herpesvirus entry mediator); tumor necrosis factor receptor superfamily member 14; ATAR; CD270; herpesvirus entry mediator; HVEA; HVEM; LIGHTR; TR2; CD40-like protein; herpesvirus entry mediator A; herpes virus entry mediator A; tumor necrosis factor receptor-like 2; tumor necrosis factor receptor-like gene2
• Gene ID: 8764
• mRNA Refseq: NM_003820
• Protein Refseq: NP_003811
• MIM: 602746
• UniProt ID: Q92956