Recombinant Human TNFRSF13C, Fc-tagged

• Cat.No.: TNFRSF13C-27432TH
• Product Overview: Recombinant fragment corresponding to the extracellular domain of Human BAFF Receptor fused to the Fc region of Human IgG1 (amino acids 93-330). The chimeric protein was expressed in modified human 293 cells.

Specification

• Species: Human
• Tag: Fc
• Protein Length: 93-330 a.a.
• Description: B cell-activating factor (BAFF) enhances B-cell survival in vitro and is a regulator of the peripheral B-cell population. Overexpression of Baff in mice results in mature B-cell hyperplasia and symptoms of systemic lupus erythematosus (SLE). Also, some SLE patients have increased levels of BAFF in serum. Therefore, it has been proposed that abnormally high levels of BAFF may contribute to the pathogenesis of autoimmune diseases by enhancing the survival of autoreactive B cells. The protein encoded by this gene is a receptor for BAFF and is a type III transmembrane protein containing a single extracellular cysteine-rich domain. It is thought that this receptor is the principal receptor required for BAFF-mediated mature B-cell survival.
• Conjugation: Fc
• Tissue specificity: Highly expressed in spleen and lymph node, and in resting B-cells. Detected at lower levels in activated B-cells, resting CD4+ T-cells, in thymus and peripheral blood leukocytes.
• Biological activity: The ED50 of TNFRSF13C-27432TH is typically 0.02-0.08 μg/ml as measured by its ability to neutralize BAFF-mediated proliferation of the RPMI 8226 cell line.
• Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not rec
• Purity: >95% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
• Storage: Store at +4°C.
• Sequences of amino acids: Theoretical sequence:SLRGRDAPAPTPCVPAECFDLLVRHCVAC GLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALP GSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHN HYTQKSLSLSPGK
• Sequence Similarities: Contains 1 TNFR-Cys repeat.

Gene Information

• Gene Name: TNFRSF13C tumor necrosis factor receptor superfamily, member 13C [ Homo sapiens ]
• Official Symbol: TNFRSF13C
• Synonyms: TNFRSF13C; tumor necrosis factor receptor superfamily, member 13C; tumor necrosis factor receptor superfamily member 13C; BAFFR; CD268
• Gene ID: 115650
• mRNA Refseq: NM_052945
• Protein Refseq: NP_443177
• MIM: 606269
• Uniprot ID: Q96RJ3
• Chromosome Location: 22q13.1-q13.3
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; Intestinal immune network for IgA production, organism-specific biosystem
• Function: receptor activity