Recombinant Human TNFAIP6 protein, GST-tagged

• Cat.No.: TNFAIP6-3005H
• Product Overview: Recombinant Human TNFAIP6(1 a.a. - 277 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 57.6 kDa
• AA Sequence: MIILIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEFEGGHLATYKQLEAAR KIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGIRLNRSERWDAYCYNPHAKECGGVFTDPKQIFKSPG FPNEYEDNQICYWHIRLKYGQRIHLSFLDFDLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVM TLKFLSDASVTAGGFQIKYVAMDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Protein length: 1-277 a.a.

Gene Information

• Gene Name: TNFAIP6 tumor necrosis factor, alpha-induced protein 6 [ Homo sapiens ]
• Official Symbol: TNFAIP6
• Synonyms: TNFAIP6; tumor necrosis factor, alpha-induced protein 6; tumor necrosis factor-inducible gene 6 protein; TSG 6; TSG6; TNF alpha-induced protein 6; hyaluronate-binding protein; TNF-stimulated gene 6 protein; tumor necrosis factor alpha-inducible protein 6; tumor necrosis factor-stimulated gene-6 protein; TSG-6
• Gene ID: 7130
• mRNA Refseq: NM_007115
• Protein Refseq: NP_009046
• MIM: 600410
• UniProt ID: P98066
• Chromosome Location: 2q23.3
• Function: binding; hyaluronic acid binding