Recombinant Human TNF Protein
Cat.No. : | TNF-79H |
Product Overview : | TNF-alpha was produced in E. coli cells transformed with human TNF-alpha gene. This product is sterile and does not contain any components of animal origin. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, psoriasis, rheumatoid arthritis ankylosing spondylitis, tuberculosis, autosomal dominant polycystic kidney disease, and cancer. Mutations in this gene affect susceptibility to cerebral malaria, septic shock, and Alzheimer disease. Knockout studies in mice also suggested the neuroprotective function of this cytokine. |
AA Sequence : | GPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
Purity : | > 95% by SDS-PAGE |
Quality Control Test : | Verified by Mass Spectrometry analysis. |
Storage : | Avoid repeated freeze-thaw cycles. 12 months at -20 to -80 centigrade. 1 month at 2 to 8 centigrade. |
Concentration : | 0.5 mg/mL |
Storage Buffer : | Sterile filtered through a 0.2 micron filter in 50% glycerol, 10 mM Tris buffer at pH 8, 50 mM NaCl |
Gene Name | TNF tumor necrosis factor [ Homo sapiens (human) ] |
Official Symbol | TNF |
Synonyms | TNF; tumor necrosis factor; DIF; TNFA; TNFSF2; TNLG1F; TNF-alpha; tumor necrosis factor; APC1 protein; TNF, macrophage-derived; TNF, monocyte-derived; TNF-a; tumor necrosis factor ligand 1F; tumor necrosis factor ligand superfamily member 2; tumor necrosis factor-alpha; tumor necrotic factor alpha |
Gene ID | 7124 |
mRNA Refseq | NM_000594 |
Protein Refseq | NP_000585 |
MIM | 191160 |
UniProt ID | P01375 |
◆ Recombinant Proteins | ||
TNF-79H | Recombinant Human TNF Protein | +Inquiry |
TNF-6471H | Recombinant Human TNF Protein (Gly57-Leu233), N-His tagged | +Inquiry |
Tnf-3766M | Recombinant Mouse Tnf Protein (Leu80-Leu235), N-His tagged | +Inquiry |
TNF-35H | Recombinant Human TNF protein, His-tagged | +Inquiry |
RFL17774SF | Recombinant Full Length Pig Tumor Necrosis Factor(Tnf) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TNF Products
Required fields are marked with *
My Review for All TNF Products
Required fields are marked with *
0
Inquiry Basket