Recombinant Human TMX2 Protein, His-tagged

• Cat.No.: TMX2-494H
• Product Overview: Recombinant Human TMX2, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: THis gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. THis protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.
• Form: Lyophilized from a 0.2 µM filtered solution of 20mM Tris, 150mM NaCl, pH8.0
• Molecular Mass: 21.9kD
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMTCKPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: TMX2 thioredoxin-related transmembrane protein 2 [ Homo sapiens ]
• Official Symbol: TMX2
• Synonyms: PIG26; CGI-31; PDIA12; TXNDC14
• Gene ID: 51075
• mRNA Refseq: NM_015959.3
• Protein Refseq: NP_057043.1
• UniProt ID: Q9Y320