Recombinant Human TMOD3, His-tagged
Cat.No. : | TMOD3-31625TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 81-263 of Human Tropomodulin 3 with an N-terminal His tag; MWt 21 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 81-263 a.a. |
Description : | Tropomodulin-3 is a protein that in humans is encoded by the TMOD3 gene. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 116 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KDREDYVPYTGEKKGKIFIPKQKPVQTFTEEKVSLDPELE EALTSASDTELCDLAAILGMHNLITNTKFCNIMGSSNG VDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRTKEN DAHLVEVNLNNIKNIPIPTLKDFAKALETNTHVKCFSL AATRSNDPVATAFAEMLKVNKTLKSLNVE |
Sequence Similarities : | Belongs to the tropomodulin family. |
Gene Name | TMOD3 tropomodulin 3 (ubiquitous) [ Homo sapiens ] |
Official Symbol | TMOD3 |
Synonyms | TMOD3; tropomodulin 3 (ubiquitous); tropomodulin-3; UTMOD; |
Gene ID | 29766 |
mRNA Refseq | NM_014547 |
Protein Refseq | NP_055362 |
MIM | 605112 |
Uniprot ID | Q9NYL9 |
Chromosome Location | 15q21.1-q21.2 |
Function | actin binding; tropomyosin binding; |
◆ Recombinant Proteins | ||
TMOD3-6959H | Recombinant Human Tropomodulin 3 (ubiquitous), His-tagged | +Inquiry |
TMOD3-4852R | Recombinant Rhesus monkey TMOD3 Protein, His-tagged | +Inquiry |
TMOD3-3305H | Recombinant Human TMOD3, GST-tagged | +Inquiry |
TMOD3-4666R | Recombinant Rhesus Macaque TMOD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmod3-6524M | Recombinant Mouse Tmod3 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMOD3-915HCL | Recombinant Human TMOD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TMOD3 Products
Required fields are marked with *
My Review for All TMOD3 Products
Required fields are marked with *
0
Inquiry Basket