Recombinant Human TMEM70 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM70-5761H
Product Overview : TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described.
Molecular Mass : 29 kDa
AA Sequence : MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM70 transmembrane protein 70 [ Homo sapiens (human) ]
Official Symbol TMEM70
Synonyms TMEM70; transmembrane protein 70; MC5DN2; transmembrane protein 70, mitochondrial
Gene ID 54968
mRNA Refseq NM_017866
Protein Refseq NP_060336
MIM 612418
UniProt ID Q9BUB7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM70 Products

Required fields are marked with *

My Review for All TMEM70 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon