Recombinant Human TMEM70 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM70-5761H
• Product Overview: TMEM70 MS Standard C13 and N15-labeled recombinant protein (NP_060336) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene likely encodes a mitochondrial membrane protein. The encoded protein may play a role in biogenesis of mitochondrial ATP synthase. Mutations in this gene have been associated with neonatal mitochondrial encephalocardiomyopathy due to ATP synthase deficiency. Alternatively spliced transcript variants have been described.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 29 kDa
• AA Sequence: MLFLALGSPWAVELPLCGRRTALCAAAALRGPRASVSRASSSSGPSGPVAGWSTGPSGAARLLRRPGRAQIPVYWEGYVRFLNTPSDKSEDGRLIYTGNMARAVFGVKCFSYSTSLIGLTFLPYIFTQNNAISESVPLPIQIIFYGIMGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM70 transmembrane protein 70 [ Homo sapiens (human) ]
• Official Symbol: TMEM70
• Synonyms: TMEM70; transmembrane protein 70; MC5DN2; transmembrane protein 70, mitochondrial
• Gene ID: 54968
• mRNA Refseq: NM_017866
• Protein Refseq: NP_060336
• MIM: 612418
• UniProt ID: Q9BUB7