Recombinant Human TMEM57 protein, His-tagged

• Cat.No.: TMEM57-3675H
• Product Overview: Recombinant Human TMEM57 protein(497-664 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: 497-664 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ASRGECTETLRNRIRELEAEGKKLTMDMKVKEDQIRELELKVQELRKYKENEKDTEVLMSALSAMQDKTQHLENSLSAETRIKLDLFSALGDAKRQLEIAQGQILQKDQEIKDLKQKIAEVMAVMPSITYSAATSPLSPVSPHYSSKFVETSPSGLDPNASVYQPLKK
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TMEM57 transmembrane protein 57 [ Homo sapiens ]
• Official Symbol: TMEM57
• Synonyms: TMEM57; transmembrane protein 57; macoilin; FLJ10747; MACOILIN; RP3-469D22.2; FLJ23007
• Gene ID: 55219
• mRNA Refseq: NM_018202
• Protein Refseq: NP_060672
• MIM: 610301
• UniProt ID: Q8N5G2