Recombinant Human TMEM263 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | TMEM263-5324H |
Product Overview : | C12orf23 MS Standard C13 and N15-labeled recombinant protein (NP_689474) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | TMEM263 (Transmembrane Protein 263) is a Protein Coding gene. Diseases associated with TMEM263 include Epithelial Basement Membrane Dystrophy and Peripheral Retinal Degeneration. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 11.7 kDa |
AA Sequence : | MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWIGGKSLEVTKTAVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | TMEM263 transmembrane protein 263 [ Homo sapiens (human) ] |
Official Symbol | TMEM263 |
Synonyms | TMEM263; transmembrane protein 263; C12orf23; transmembrane protein 263; UPF0444 transmembrane protein C12orf23 |
Gene ID | 90488 |
mRNA Refseq | NM_152261 |
Protein Refseq | NP_689474 |
UniProt ID | Q8WUH6 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TMEM263 Products
Required fields are marked with *
My Review for All TMEM263 Products
Required fields are marked with *
0
Inquiry Basket