Recombinant Human TMEM263 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMEM263-5324H
• Product Overview: C12orf23 MS Standard C13 and N15-labeled recombinant protein (NP_689474) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TMEM263 (Transmembrane Protein 263) is a Protein Coding gene. Diseases associated with TMEM263 include Epithelial Basement Membrane Dystrophy and Peripheral Retinal Degeneration.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.7 kDa
• AA Sequence: MNQTDKNQQEIPSYLNDEPPEGSMKDHPQQQPGMLSRVTGGIFSVTKGAVGATIGGVAWIGGKSLEVTKTAVTTVPSMGIGLVKGGVSAVAGGVTAVGSAVVNKVPLTGKKKDKSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMEM263 transmembrane protein 263 [ Homo sapiens (human) ]
• Official Symbol: TMEM263
• Synonyms: TMEM263; transmembrane protein 263; C12orf23; transmembrane protein 263; UPF0444 transmembrane protein C12orf23
• Gene ID: 90488
• mRNA Refseq: NM_152261
• Protein Refseq: NP_689474
• UniProt ID: Q8WUH6