Recombinant Human TMEM208 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TMEM208-4941H
Product Overview : TMEM208 MS Standard C13 and N15-labeled recombinant protein (NP_054906) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a highly conserved protein which is localized in the endoplasmic reticulum (ER). The protein is linked to autophagy and ER stress. Knockdown of this gene increased autophagy and triggered ER stress. Alternative splicing results in multiple transcript variants.
Molecular Mass : 19.6 kDa
AA Sequence : MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TMEM208 transmembrane protein 208 [ Homo sapiens (human) ]
Official Symbol TMEM208
Synonyms TMEM208; transmembrane protein 208; hSND2; HSPC171; transmembrane protein 208; SRP-independent targeting 2 homolog
Gene ID 29100
mRNA Refseq NM_014187
Protein Refseq NP_054906
UniProt ID Q9BTX3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TMEM208 Products

Required fields are marked with *

My Review for All TMEM208 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon