Recombinant Human TMEM106B, GST-tagged

• Cat.No.: TMEM106B-3274H
• Product Overview: Recombinant Human TMEM106B(150-274 aa), fused with a GST tag at the N-terminus, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Protein length: 150-274 aa
• Form: Lyophilized from sterile PBS, pH7.4, 0.3% SKL, 5% Trehalose, 5% Mannitol.
• Molecular Mass: The protein has a calculated MW of 40.72 kDa.
• AASequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.86mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Official Symbol: TMEM106B

Reviews

06/11/2024

TMEM106B-3274H

It took a while for us to test it but it looks to be working well for us. We would definitely like to purchase more.