Recombinant Human TMC7 Protein, N-His6-ABP tagged

• Cat.No.: TMC7-04H
• Product Overview: Recombinant Human TMC7 Protein with a N-terminal His6-ABP tag was produced in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: ABP&His
• Description: Predicted to enable mechanosensitive ion channel activity. Predicted to be involved in ion transmembrane transport. Predicted to be integral component of plasma membrane.
• Molecular Mass: 32 kDa
• AA Sequence: LDSSCFSSPPVNFLQELPSYRSIARRRTTVHSRDKQSGTLLKPTDSYSSQLEDRIAENLSSHSLRNYALNISEKRRLRDIQETQMKYLSEWDQWKRYSSKSWKRFLEKAREMTTHLE
• Purity: > 80% by SDS-PAGE and Coomassie blue staining
• Applications: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody.
• Storage: Store at -20 centigrade. Avoid freeze-thaw cycles.
• Concentration: It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/mL.
• Storage Buffer: PBS and 1M Urea, pH 7.4.

Gene Information

• Gene Name: TMC7 transmembrane channel-like 7 [ Homo sapiens (human) ]
• Official Symbol: TMC7
• Synonyms: TMC7; transmembrane channel-like 7; transmembrane channel-like protein 7; FLJ21240; DKFZp781O2274
• Gene ID: 79905
• mRNA Refseq: NM_001160364
• Protein Refseq: NP_001153836
• MIM: 617198
• UniProt ID: Q7Z402