Recombinant Human TMA7 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TMA7-1585H
• Product Overview: CCDC72 MS Standard C13 and N15-labeled recombinant protein (NP_057017) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TMA7 (Translation Machinery Associated 7 Homolog) is a Protein Coding gene. An important paralog of this gene is ENSG00000225528.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.1 kDa
• AA Sequence: MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TMA7 translation machinery associated 7 homolog [ Homo sapiens (human) ]
• Official Symbol: TMA7
• Synonyms: CCDC72; HSPC016; translation machinery-associated protein 7; coiled-coil domain containing 72; coiled-coil domain-containing protein 72; translational machinery associated 7 homolog; TMA7
• Gene ID: 51372
• mRNA Refseq: NM_015933
• Protein Refseq: NP_057017
• MIM: 615808
• UniProt ID: Q9Y2S6