Recombinant Human TLR4 protein, His-tagged
Cat.No. : | TLR4-2262H |
Product Overview : | Recombinant Human TLR4 protein(O00206)(27-631aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 27-631aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 69.8 kDa |
AA Sequence : | EPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMNK |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TLR4 toll-like receptor 4 [ Homo sapiens ] |
Official Symbol | TLR4 |
Synonyms | TLR4; toll-like receptor 4; CD284; hToll; TLR 4; homolog of Drosophila toll; TOLL; TLR-4; ARMD10; |
Gene ID | 7099 |
mRNA Refseq | NM_003266 |
Protein Refseq | NP_003257 |
UniProt ID | O00206 |
◆ Recombinant Proteins | ||
TLR4-293H | Recombinant Human TLR4 | +Inquiry |
TLR4-614HFL | Recombinant Full Length Human TLR4 Protein, C-Flag-tagged | +Inquiry |
TLR4-1675R | Recombinant Rhesus Monkey TLR4 Protein, hIgG4-tagged | +Inquiry |
Tlr4-5532M | Recombinant Mouse Tlr4 protein, His-tagged | +Inquiry |
TLR4-141H | Recombinant Human TLR4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR4-402HCL | Recombinant Human TLR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TLR4 Products
Required fields are marked with *
My Review for All TLR4 Products
Required fields are marked with *
0
Inquiry Basket