Recombinant Human TLDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TLDC2-3216H
• Product Overview: C20orf118 MS Standard C13 and N15-labeled recombinant protein (NP_542195) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TLDC2 (TBC/LysM-Associated Domain Containing 2) is a Protein Coding gene. Diseases associated with TLDC2 include Aicardi-Goutieres Syndrome 5 and Chilblain Lupus 2. An important paralog of this gene is NCOA7.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 23.9 kDa
• AA Sequence: MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TLDC2 TBC/LysM-associated domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: TLDC2
• Synonyms: TLDC2; TBC/LysM-associated domain containing 2; C20orf118; TLD domain-containing protein 2; TBC/LysM-associated domain-containing protein 2
• Gene ID: 140711
• mRNA Refseq: NM_080628
• Protein Refseq: NP_542195
• UniProt ID: A0PJX2