Recombinant Human TIE1 Protein, N-His tagged, Biotinylated

• Cat.No.: TIE1-101HB
• Product Overview: Biotinylated recombinant Human TIE1 protein with N-His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes a member of the tyrosine protein kinase family. The encoded protein plays a critical role in angiogenesis and blood vessel stability by inhibiting angiopoietin 1 signaling through the endothelial receptor tyrosine kinase Tie2. Ectodomain cleavage of the encoded protein relieves inhibition of Tie2 and is mediated by multiple factors including vascular endothelial growth factor. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Molecular Mass: 46.9 kDa
• AA Sequence: MHHHHHHSSGLVPRGSHMASMTGGQQMGRGSAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSGFWEC
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.05 mg/mL
• Storage Buffer: 50mM Tris pH9.0, 300mM NaCl, 20% Glycerol

Gene Information

• Gene Name: TIE1 tyrosine kinase with immunoglobulin-like and EGF-like domains 1 [ Homo sapiens (human) ]
• Official Symbol: TIE1
• Synonyms: TIE1; tyrosine kinase with immunoglobulin-like and EGF-like domains 1; TIE, tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; tyrosine-protein kinase receptor Tie-1; JTK14; tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1; TIE
• Gene ID: 7075
• mRNA Refseq: NM_001253357
• Protein Refseq: NP_001240286
• MIM: 600222
• UniProt ID: P35590