Recombinant Human THY1 Protein, His-tagged

• Cat.No.: THY1-139H
• Product Overview: Recombinant Human THY1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The Thy1/CD90 cell surface antigen is a GPI-anchored, developmentally regulated protein involved in signaling cascades that mediate neurite outgrowth, T cell activation, tumor suppression, apoptosis, and fibrosis. Thy1/CD90 is highly expressed on the surface of adult neurons and is thought to play a role in modulating adhesive and migratory events, such as neurite extension. Decreased Thy1/CD90 mRNA and protein expression is associated with the development of epithelial ovarian cancer, suggesting a role as a putative tumor suppressor gene of human ovarian cancer. Research studies indicate that Thy1/CD90 knockout mice have impaired cutaneous immune responses and abnormal retinal development. Thy1/CD90 is epigenetically regulated or deregulated in some disease states, such as pulmonary fibrosis. The potentially reversible hypermethylation of the Thy1/CD90 promoter offers the possibility of novel therapeutic options in this disease.
• Molecular Mass: ~17 kDa
• AA Sequence: MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: THY1 Thy-1 cell surface antigen [ Homo sapiens (human) ]
• Official Symbol: THY1
• Synonyms: THY1; Thy-1 cell surface antigen; thy-1 membrane glycoprotein; CD90; CDw90; thy-1 antigen; Thy-1 T-cell antigen; FLJ33325
• Gene ID: 7070
• mRNA Refseq: NM_006288
• Protein Refseq: NP_006279
• MIM: 188230
• UniProt ID: P04216