Recombinant Human THY1 Protein, His-tagged
Cat.No. : | THY1-139H |
Product Overview : | Recombinant Human THY1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The Thy1/CD90 cell surface antigen is a GPI-anchored, developmentally regulated protein involved in signaling cascades that mediate neurite outgrowth, T cell activation, tumor suppression, apoptosis, and fibrosis. Thy1/CD90 is highly expressed on the surface of adult neurons and is thought to play a role in modulating adhesive and migratory events, such as neurite extension. Decreased Thy1/CD90 mRNA and protein expression is associated with the development of epithelial ovarian cancer, suggesting a role as a putative tumor suppressor gene of human ovarian cancer. Research studies indicate that Thy1/CD90 knockout mice have impaired cutaneous immune responses and abnormal retinal development. Thy1/CD90 is epigenetically regulated or deregulated in some disease states, such as pulmonary fibrosis. The potentially reversible hypermethylation of the Thy1/CD90 promoter offers the possibility of novel therapeutic options in this disease. |
Molecular Mass : | ~17 kDa |
AA Sequence : | MQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKC |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | THY1 Thy-1 cell surface antigen [ Homo sapiens (human) ] |
Official Symbol | THY1 |
Synonyms | THY1; Thy-1 cell surface antigen; thy-1 membrane glycoprotein; CD90; CDw90; thy-1 antigen; Thy-1 T-cell antigen; FLJ33325; |
Gene ID | 7070 |
mRNA Refseq | NM_006288 |
Protein Refseq | NP_006279 |
MIM | 188230 |
UniProt ID | P04216 |
◆ Recombinant Proteins | ||
THY1-586H | Active Recombinant Human THY1, Fc-tagged | +Inquiry |
THY1-4523R | Recombinant Rhesus Macaque THY1 Protein, His (Fc)-Avi-tagged | +Inquiry |
THY1-6061R | Recombinant Rat THY1 Protein | +Inquiry |
Thy1-3580M | Recombinant Mouse Thy1 protein, His-SUMO-tagged | +Inquiry |
Thy1-6911M | Recombinant Mouse Thy1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
THY1-952CCL | Recombinant Cynomolgus THY1 cell lysate | +Inquiry |
THY1-1297RCL | Recombinant Rat THY1 cell lysate | +Inquiry |
THY1-2384MCL | Recombinant Mouse THY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THY1 Products
Required fields are marked with *
My Review for All THY1 Products
Required fields are marked with *
0
Inquiry Basket