Recombinant Human THBS1 protein, His-tagged
Cat.No. : | THBS1-3321H |
Product Overview : | Recombinant Human THBS1 protein(25-250 aa), fused to His tag, was expressed in E. coli. |
Availability | April 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-250 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | GGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFRIEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | THBS1 thrombospondin 1 [ Homo sapiens ] |
Official Symbol | THBS1 |
Synonyms | THBS1; thrombospondin 1; thrombospondin-1; THBS; THBS 1; thrombospondin 1p180; TSP; TSP 1; TSP1; thrombospondin-1p180; TSP-1; THBS-1; |
Gene ID | 7057 |
mRNA Refseq | NM_003246 |
Protein Refseq | NP_003237 |
MIM | 188060 |
UniProt ID | P07996 |
◆ Recombinant Proteins | ||
Thbs1-2660M | Recombinant Mouse Thbs1 protein, His-tagged | +Inquiry |
THBS1-2656C | Recombinant Cattle THBS1 protein, His & T7-tagged | +Inquiry |
Thbs1-2662R | Recombinant Rat Thbs1 protein, His-tagged | +Inquiry |
THBS1-31513TH | Recombinant Human THBS1 protein, glycosylated | +Inquiry |
THBS1-31516TH | Recombinant Human THBS1 | +Inquiry |
◆ Native Proteins | ||
THBS1-4946H | Native Human Thrombospondin protein | +Inquiry |
THBS1-31514TH | Native Human THBS1 | +Inquiry |
THBS1-31515TH | Native Human THBS1 | +Inquiry |
THBS1-5524H | Natve Human Thrombospondin | +Inquiry |
◆ Cell & Tissue Lysates | ||
THBS1-1101HCL | Recombinant Human THBS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All THBS1 Products
Required fields are marked with *
My Review for All THBS1 Products
Required fields are marked with *
0
Inquiry Basket