Recombinant Human TGFB3 Protein

• Cat.No.: TGFB3-125H
• Product Overview: Recombinant Human/Mouse Transforming Growth Factor beta 3 is produced by our Mammalian expression system and the target gene encoding Ala301-Ser412(Tyr340Phe) is expressed.

Specification

• Species: Human
• Source: Human Cells
• Protein Length: Ala301-Ser412(Tyr340Phe)
• Description: Transforming growth factor beta 3(TGFB3) is a member of a TGF -β superfamily which is defined by theirstructural and functional similarities. TGFB3 is secreted as a complex with LAP. This latent form of TGFB3becomes active upon cleavage by plasmin, matrix metalloproteases, thrombospondin -1, and a subset ofintegrins. It binds with high affinity to TGF- β RII, a type II serine/threonine kinase receptor. TGFB3 is involved incell differentiation, embryogenesis and development.It is believed to regulate molecules involved in cellularadhesion and extracellular matrix (ECM) formation during the process of palate development. Without TGF-β3,mammals develop a deformity known as a cleft palate.
• Form: Lyophilized from a 0.2 um filtered solution of 4 mM HCl.
• AA Sequence: ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYFANFCSGPCPYLRSADTTHSTVLGLYNTL NPEASASPCCVPQDLE PLTILYYVGRTPKVEQLSNMVVKSCKCS
• Endotoxin: Less than 0.1 ng/ug (1 EU/ug).
• Purity: >95%
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100μg/ml.
  Dissolve the lyophilized protein in distilled water.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Quality Statement: Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Shipping: The product is shipped at ambient temperature.
  Upon receipt, store it immediately at the temperature listed below.

Gene Information

• Gene Name: TGFB3 transforming growth factor beta 3 [ Homo sapiens (human) ]
• Official Symbol: TGFB3
• Synonyms: Transforming growth factor beta-3; TGF-beta-3; Latency-associated peptide; LAP; ARVD; LDS5; RNHF; ARVD1
• Gene ID: 7043
• mRNA Refseq: NM_001329938.2
• Protein Refseq: NP_001316867.1
• MIM: 190230
• UniProt ID: P10600