Recombinant Human TGFB1 protein, GST-tagged
Cat.No. : | TGFB1-4322H |
Product Overview : | Recombinant Human TGFB1(1 a.a. - 390 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-390 a.a. |
Description : | This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 70.7 kDa |
AA Sequence : | MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPE AVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVLL SRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSC DSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPK VEQLSNMIVRSCKCS |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TGFB1 transforming growth factor, beta 1 [ Homo sapiens ] |
Official Symbol | TGFB1 |
Synonyms | TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide; LAP; DPD1; TGFB; |
Gene ID | 7040 |
mRNA Refseq | NM_000660 |
Protein Refseq | NP_000651 |
MIM | 190180 |
UniProt ID | P01137 |
Chromosome Location | 19q13.1 |
Pathway | ACE Inhibitor Pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Cell cycle, organism-specific biosystem; Cell cycle, organism-specific biosystem; |
Function | enzyme binding; eukaryotic cell surface binding; growth factor activity; protein N-terminus binding; protein binding; protein heterodimerization activity; protein homodimerization activity; type II transforming growth factor beta receptor binding; type II transforming growth factor beta receptor binding; |
◆ Recombinant Proteins | ||
Tgfb1-3570R | Recombinant Rat Tgfb1 protein, His-tagged | +Inquiry |
Tgfb1-5071R | Recombinant Rat Tgfb1 protein, His-tagged | +Inquiry |
TGFB1-17H | Active Recombinant Human TGFB1 Protein, Pre-aliquoted | +Inquiry |
TGFB1-103H | Active Recombinant Human TGFB1 Protein | +Inquiry |
TGFB1-1283H | Recombinant Human TGFB1 Protein (M1-S390), His tagged | +Inquiry |
◆ Native Proteins | ||
TGFB1-21H | Active Native Human TGF- β1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFB1-2662HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-001HCL | Recombinant Human TGFB1 cell lysate | +Inquiry |
TGFB1-001MCL | Recombinant Mouse TGFB1 cell lysate | +Inquiry |
TGFB1-803RCL | Recombinant Rat TGFB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TGFB1 Products
Required fields are marked with *
My Review for All TGFB1 Products
Required fields are marked with *
0
Inquiry Basket