Recombinant Human TGFB1 protein(281-390 aa), N-MBP & C-His-tagged

• Cat.No.: TGFB1-2510H
• Product Overview: Recombinant Human TGFB1 protein(P01137)(281-390 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His&MBP
• Protein Length: 281-390 aa
• Form: 0.15 M Phosphate buffered saline
• Molecular Mass: 55 kDa
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Gene Information

• Gene Name: TGFB1 transforming growth factor, beta 1 [ Homo sapiens ]
• Official Symbol: TGFB1
• Synonyms: TGFB1; transforming growth factor, beta 1; DPD1, TGFB; transforming growth factor beta-1; Camurati Engelmann disease; CED; TGFbeta; TGF-beta-1; TGF-beta 1 protein; latency-associated peptide; LAP; DPD1; TGFB
• Gene ID: 7040
• mRNA Refseq: NM_000660
• Protein Refseq: NP_000651
• MIM: 190180
• UniProt ID: P01137