Recombinant Human TEX37 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TEX37-5739H
• Product Overview: C2orf51 MS Standard C13 and N15-labeled recombinant protein (NP_689883) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TEX37 (Testis Expressed 37) is a Protein Coding gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 20.6 kDa
• AA Sequence: MAGVKYPGQDPVDLDIYQSSHMVDYQPYRKHKYSRVTPQEQAKLDAQLRDKEFYRPIPNPNPKLTDGYPAFKRPHMTAKDLGLPGFFPSQEHEATREDERKFTSTCHFTYPASHDLHLAQGDPNQVLQSADFPCLVDPKHQPAAEMAKGYLLLPGCPCLHCHIVKVPILNRWGPLMPFYQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TEX37 testis expressed 37 [ Homo sapiens (human) ]
• Official Symbol: TEX37
• Synonyms: TEX37; testis expressed 37; TSC21; C2orf51; testis-expressed sequence 37 protein; Testis-Specific Conserved gene 21kDa; protein TSC21; testis tissue sperm-binding protein Li 93mP; testis-specific conserved protein of 21 kDa
• Gene ID: 200523
• mRNA Refseq: NM_152670
• Protein Refseq: NP_689883
• UniProt ID: Q96LM6