Recombinant Human TESC protein, His-SUMO-tagged

• Cat.No.: TESC-3561H
• Product Overview: Recombinant Human TESC protein(Q96BS2)(2-214aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 2-214aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.6 kDa
• AA Sequence: GAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TESC tescalcin [ Homo sapiens ]
• Official Symbol: TESC
• Synonyms: TESC; tescalcin; FLJ20607; TSC; calcineurin B homologous protein 3; CHP3
• Gene ID: 54997
• mRNA Refseq: NM_001168325
• Protein Refseq: NP_001161797
• MIM: 611585
• UniProt ID: Q96BS2