Recombinant Human TEAD4 Protein (74-434 aa), His-SUMO-tagged
Cat.No. : | TEAD4-1005H |
Product Overview : | Recombinant Human TEAD4 Protein (74-434 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Transcription. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 74-434 aa |
Description : | Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (T) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 56.7 kDa |
AA Sequence : | MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | TEAD4 TEA domain family member 4 [ Homo sapiens ] |
Official Symbol | TEAD4 |
Synonyms | TEAD4; TCF13L1; EFTR 2; RTEF 1; TEF 3; TEFR 1; TEF3; RTEF1; TEF-3; EFTR-2; TEFR-1; hRTEF-1B; MGC9014; |
Gene ID | 7004 |
mRNA Refseq | NM_003213 |
Protein Refseq | NP_003204 |
MIM | 601714 |
UniProt ID | Q15561 |
◆ Recombinant Proteins | ||
TEAD4-1101C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-1099C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-4397H | Recombinant Human TEAD4 protein, GST-tagged | +Inquiry |
TEAD4-1100C | Recombinant Chicken TEAD4 | +Inquiry |
TEAD4-4396H | Recombinant Human TEAD4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TEAD4-1758HCL | Recombinant Human TEAD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TEAD4 Products
Required fields are marked with *
My Review for All TEAD4 Products
Required fields are marked with *
0
Inquiry Basket