Recombinant Human TEAD2 protein, His-tagged

• Cat.No.: TEAD2-33H
• Product Overview: Recombinant Human TEAD2 protein(121-251 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 121-251 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: TEAD2 TEA domain family member 2 [ Homo sapiens ]
• Official Symbol: TEAD2
• Synonyms: TEAD2; TEA domain family member 2; transcriptional enhancer factor TEF-4; ETF; TEF 4; TEF4; TEF-4; TEAD-2
• Gene ID: 8463
• mRNA Refseq: NM_001256658
• Protein Refseq: NP_001243587
• MIM: 601729
• UniProt ID: Q15562