Recombinant Human TCTA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : TCTA-3532H
Product Overview : TCTA MS Standard C13 and N15-labeled recombinant protein (NP_071503) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : May be required for cellular fusion during osteoclastogenesis.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 11.3 kDa
AA Sequence : MAESWSGQALQALPATVLGALGSEFLREWEAQDMRVTLFKLLLLWLVLSLLGIQLAWGFYGNTVTGLYHRPGLGGQNGSTPDGSTHFPSWEMAANEPLKTHRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name TCTA T cell leukemia translocation altered [ Homo sapiens (human) ]
Official Symbol TCTA
Synonyms TCTA; T cell leukemia translocation altered; T-cell leukemia translocation-altered gene protein; T-cell leukemia translocation-associated gene protein
Gene ID 6988
mRNA Refseq NM_022171
Protein Refseq NP_071503
MIM 600690
UniProt ID P57738

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TCTA Products

Required fields are marked with *

My Review for All TCTA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon