Recombinant Human TCEAL1, His-tagged

Cat.No. : TCEAL1-30813TH
Product Overview : Recombinant full length Human TCEAL1 Isoform 2 with C terminal His tag; 167 amino acids with tag; Predicted MWt 19.7 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is similar to transcription elongation factor A/transcription factor SII and contains a zinc finger-like motif as well as a sequence related to the transcription factor SII Pol II-binding region. It may exert its effects via protein-protein interactions with other transcriptional regulators rather than via direct binding of DNA. Multiple family members are located on the X chromosome. Alternative splicing results in multiple transcript variants encoding a single isoform.
Protein length : 159 amino acids
Conjugation : HIS
Molecular Weight : 19.700kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several cancer cell lines.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSEEEFFPEELLPELLPEMLLSEERPPQEGLSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAKRSRPYPILEHHHHHH
Sequence Similarities : Belongs to the TFS-II family. TFA subfamily.
Gene Name TCEAL1 transcription elongation factor A (SII)-like 1 [ Homo sapiens ]
Official Symbol TCEAL1
Synonyms TCEAL1; transcription elongation factor A (SII)-like 1; transcription elongation factor A protein-like 1; P21; p21; pp21; SIIR;
Gene ID 9338
mRNA Refseq NM_001006639
Protein Refseq NP_001006640
MIM 300237
Uniprot ID Q15170
Chromosome Location Xq22.1
Function sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All TCEAL1 Products

Required fields are marked with *

My Review for All TCEAL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon