Recombinant Human TBCEL protein, His-SUMO-tagged

• Cat.No.: TBCEL-4523H
• Product Overview: Recombinant Human TBCEL protein(Q5QJ74)(1-424aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 64.2 kDa
• Protein length: 1-424aa
• AA Sequence: MDQPSGRSFMQVLCEKYSPENFPYRRGPGMGVHVPATPQGSPMKDRLNLPSVLVLNSCGITCAGDEKEIAAFCAHVSELDLSDNKLEDWHEVSKIVSNVPQLEFLNLSSNPLNLSVLERTCAGSFSGVRKLVLNNSKASWETVHMILQELPDLEELFLCLNDYETVSCPSICCHSLKLLHITDNNLQDWTEIRKLGVMFPSLDTLVLANNHLNAIEEPDDSLARLFPNLRSISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARLPSVSKLNGSVVTDGEREDSERFFIRYYVDVPQEEVPFRYHELITKYGKLEPLAEVDLRPQSSAKVEVHFNDQVEEMSIRLDQTVAELKKQLKTLVQLPTSNMLLYYFDHEAPFGPEEMKYSSRALHSFGIRDGDKIYVESKTK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: TBCEL tubulin folding cofactor E-like [ Homo sapiens ]
• Official Symbol: TBCEL
• Synonyms: TBCEL; tubulin folding cofactor E-like; leucine rich repeat containing 35 , LRRC35, tubulin specific chaperone e like; tubulin-specific chaperone cofactor E-like protein; MGC10233; E-like; catastrophin; leucine rich repeat containing 35; tubulin-specific chaperone e-like; leucine-rich repeat-containing protein 35; El; LRRC35; FLJ14177
• Gene ID: 219899
• mRNA Refseq: NM_001130047
• Protein Refseq: NP_001123519
• MIM: 610451
• UniProt ID: Q5QJ74